PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20108.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 1034aa    MW: 110943 Da    PI: 7.0259
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20108.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB161.11.6e-50861956197
                    NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                              vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea ++cqre+rkti+++d+lwa+++lGf+dy+epl++y
  mrna20108.1-v1.0-hybrid 861 VREQDRFMPIANVIRIMRKILPPHAKISEDAKETIQECVSEYISFITGEA-KRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLY 945
                              59***********************************************9.59********************************* PP

                    NF-YB  87 lkkyrelegek 97 
                              l+++re+eg++
  mrna20108.1-v1.0-hybrid 946 LHRFREMEGDR 956
                              *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF059221.2E-2235147IPR010259Peptidase S8 propeptide/proteinase inhibitor I9
SuperFamilySSF527432.49E-69147192IPR000209Peptidase S8/S53 domain
CDDcd048528.15E-117147653No hitNo description
Gene3DG3DSA:3.40.50.2003.5E-70161193IPR000209Peptidase S8/S53 domain
PfamPF000821.8E-39172657IPR000209Peptidase S8/S53 domain
PRINTSPR007239.6E-19172191IPR015500Peptidase S8, subtilisin-related
PROSITE patternPS001360177188IPR023827Peptidase S8, subtilisin, Asp-active site
SuperFamilySSF527432.49E-69220424IPR000209Peptidase S8/S53 domain
Gene3DG3DSA:3.40.50.2003.5E-70233384IPR000209Peptidase S8/S53 domain
PRINTSPR007239.6E-19251264IPR015500Peptidase S8, subtilisin-related
CDDcd021204.82E-13392533No hitNo description
Gene3DG3DSA:3.40.50.2003.5E-70557708IPR000209Peptidase S8/S53 domain
SuperFamilySSF527432.49E-69561698IPR000209Peptidase S8/S53 domain
PRINTSPR007239.6E-19616632IPR015500Peptidase S8, subtilisin-related
PROSITE patternPS001380617627IPR023828Peptidase S8, subtilisin, Ser-active site
Gene3DG3DSA:1.10.20.102.2E-46856964IPR009072Histone-fold
SuperFamilySSF471131.29E-33864963IPR009072Histone-fold
PfamPF008089.9E-22867930IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0004252Molecular Functionserine-type endopeptidase activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1034 aa     Download sequence    Send to blast
MGRIHGVHLV VLLILGMVLS SWCQDDEDSD NISAVYIVTL KQAPIAHYLA EARKNSQGLN  60
GDTERLSIHK PRSINISRTD PKYGSYIARV HDSLLRRALK GEKYLKLYSY HYLINGFAVL  120
VTPDQVNKLS RRREVANVVL DFSVRTATTH TPQFLGLPQG AWVQEGGFKS AGEGVVIGFI  180
DTGIDPTHSS FADNSKHPYP VPAHFSGVCE VTRDFPSGSC NRKLIAARHF AASAITRGVF  240
NISQDYASPF DGDGHGTHTA SIAAGNHGIP VVVAGHQFGH ASGMAPRSHI AVYKALYKSF  300
GGFAADVVAA IDQAAQDGVD IISLSITPNR RPPGVATFFN PIDMASLSAV KVGIFVVQAA  360
GNTGPSPKSM SSFSPWIFTV GSASHDRTYS NSITLGNNVT IPGVGLAPAT QNDTVYTLIS  420
AMHALNNDTT VTDDMYVSEC QDSSNFNQDL VQGNVLICSY SIRFVLGMST IQQALQTAQN  480
LSAVGVVFYM DSFMIGFQLN PTPMKMPGII ISSPEDSKAF IQYYNRSLER DITTGKIIKF  540
GAVAAICGGT KANYSNISPK VMYYSARGPD PEDNSFDIAD IMKPNLVAPG NSIWAAWSSV  600
GADSVEFQGE SFAMLSGTSM AAPHVAGLAA LVKQKFPNFS PSAIASALST SASLYDKTGG  660
PIMAQRAYAF PDQNQSPATP FDMGSGFVNA TGALNPGLIF DSSYDNYMSF LCGINGSAPV  720
VLNYTGHSCW VYNSTINAGD LNLPSITIAN LNQSRTVLRT VINVAGNESY SVGWSAPFGV  780
SLKVSPSHFY IASGETQVLS VFFNATSNSA AASYGRIGLF GNQGLTLSEI NMKLAEINYS  840
TKNNAAITNN GGATDDNECT VREQDRFMPI ANVIRIMRKI LPPHAKISED AKETIQECVS  900
EYISFITGEA KRCQREQRKT ITAEDVLWAM SKLGFDDYIE PLTLYLHRFR EMEGDRGSMR  960
AESTLIKTTG GTRAAMTAAE YHAAAAAGSF AAGFAPFHHH HGFFGYLKNG AGTSLSHQAL  1020
ANGDHLQASS HSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3i6s_A4e-711487861592Subtilisin-like protease
3i6s_B4e-711487861592Subtilisin-like protease
3i74_A4e-711487861592Subtilisin-like protease
3i74_B4e-711487861592Subtilisin-like protease
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1155811e-150KM115581.1 UNVERIFIED: Rosa canina leafy cotyledon 1-B protein-like (LEC1-B) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460437.10.0PREDICTED: subtilisin-like protease
SwissprotQ9SUN60.0SBT22_ARATH; Subtilisin-like protease SBT2.2
TrEMBLM5WFH50.0M5WFH5_PRUPE; Uncharacterized protein
STRINGVIT_10s0092g00170.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-60nuclear factor Y, subunit B6